Phase 3: alignment assessment and phylogeny reconstruction¶
The third phase of VESPA combines multiple third-party programs (i.e. MetAl [Blackburne and Whelan, 2012] and NorMD [Thompson et al., 2001]) to automate the assessment and choice of protein Multiple Sequence Alignments (MSAs). In addition this phase enables simplified large-scale phylogenetic reconstruction. Alignment error is reported to cause high rates of false positives in a selective pressure analysis [Fletcher and Yang, 2010]. Therefore, VESPA incorporates third-party programs for MSA comparison and scoring. A complete analysis of the MSAs from each method is recommended. The next step in this phase is the selection of the empirical model of evolution that best-fits each MSA [Darriba et al., 2011; Keane et al., 2006]. The third phase concludes with an automated method for generating the files necessary for phylogenetic reconstruction using the previously selected MSA and model of evolution. The functions of this phase are primarily designed to interface with selected third-party programs. However, each step of this phase has been made optional if the user has other preferences or needs.
# To do Muscle alignment, use the following script, saved as a muscle_script.sh file
for i in *.fasta
do
muscle -in $i -out $i.mu
done
#$ -cwd
#$ -V
#$ -l h_rt=2:00:00
# Run from inside the informative SGO fasta file folder, completes within seconds, maybe a couple of minutes. Check the output files once done, saved in the same folder with a .mu suffix. make a new directory - Muscle_Output. Move *.mu file into it.
# For Mafft alignment, use the following script
#$ -cwd
#$ -V
#$ -l node_type=48core-3T
#$ -l h_rt=48:00:00
#$ -l h_vmem=32G
#$ -m be
#$ -M fbsisi@leeds.ac.uk
#$ -o mafft.out
#$ -e mafft.err
mkdir Mafft_Output
for i in *.fasta
do
mafft --auto --thread 2 $i > Mafft_Output/$i.mft
done
# Run from inside the SGO fasta file folder, completes within a couple of minutes. Check the output files once done, saved in the Mafft_Output folder created by the script.
# For Prank alignment, first we need to remove the pipe between the species common name and the gene ID and replace it with a space - in the gene headers. This is because Ali figured out that Prank does not recognise short names in gene headers that don’t have a space between the species common name and the gene ID. Or it uses the space to truncate the names. Even underscore doesn’t work. And if there is an underscore or |, running prank produces no outputs, but also no errors!!.
# So create a copy of all the .fasta files
mkdir Prank_Input
cp *.fasta Prank_Input
cd Prank_Input
# Use sed to replace the 1st pipe “|” in every header with a space
sed -i ’s/|/ /‘ *.fasta
# -i overwrites the .fasta files inside the Prank_Input folder. Leaving out the ‘g’ from the command makes sure the placement is not global. i.e., it will replace only the 1st instance in every line. So you get
>Tenrec XM_004699007.1
MPSLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYRRPGYGAYDAFKHAVSDPAILDSLDLNENERRVLIDNI
NRRLTPQAVKIRAGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLERTEGLSV
LNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEVDGDDDAEEME
AKAED
>Dolphin ENSTTRG00000015806|ENSTTRT00000015805
MPGLSCRFYQHKFPEVDDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDGLDLNEDEREVLINNI
NRRLTPQAVKIRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
>Macaque ENSMMUG00000021419|ENSMMUT00000030152
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
# For Prank alignments using a guide tree, put a copy of the nested parentheses tree in the Prank_Input folder. It is very very important that the names used in the guide tree are identical to the ones used in the sequence files!! Then run the script
SAMPLES=*.fasta
COMMANDS=()
for S in $SAMPLES; do COMMANDS+=("prank -d=${S} -o=${S}.pk -t=19MammalsTree.txt -prunetree -shortnames -once -nobppa 2> prank_job.${SGE_TASK_ID}.std.err 1> prank_job.${SGE_TASK_ID}.std.out"); done
#$ -cwd
#$ -V
#$ -l h_rt=48:00:00 #$ -l h_vmem=8G #$ -t 1-426 #$ -tc 426 #$ -o prank.out #$ -e prank.err
eval ${COMMANDS[$SGE_TASK_ID-1]}
# Make sure the number in -t and -tc is the total number of .fasta files you will use as input - changes for similarity and reciprocal groups. Make sure the name of the guide tree is correct. I tried paying the whole text of the nested parentheses tree in the command - the help section of Prank says it should be possible. But didn’t work. I think the parentheses in the guide tree were confusing for the script.
# The whole run takes a few minutes. Make a Prank_Ouput directory in the SGO folder and move all the *.fas files from Prank_Input to Prank_Output.
# For alignments without a guide tree, use the following script
SAMPLES=*.fasta
COMMANDS=()
for S in $SAMPLES; do COMMANDS+=("prank -d=${S} -o=${S}.pk -prunetree -shortnames -nobppa 2> prank_job.${SGE_TASK_ID}.std.err 1> prank_job.${SGE_TASK_ID}.std.out"); done
#$ -cwd
#$ -V
#$ -l h_rt=48:00:00 #$ -l h_vmem=8G #$ -t 1-426 #$ -tc 426 #$ -o prank.out #$ -e prank.err
eval ${COMMANDS[$SGE_TASK_ID-1]}
# Put all the output files into a folder Prank_Output_notree in the SGO folder.
# Prank outputs have short names, need to add the gene ID headers again, use Ray's python script (vespa_ChangeNamesToOriginalLongFormat.py)
import glob
for file in glob.glob('*.fasta'):
#make map
with open(file, 'r') as f1:
longSpNames={}
for line1 in f1:
if line1.startswith(">"):
spName=line1.strip().split(" ")[0]
longSpNames[spName]=line1.strip()
else:
continue
shortAli_name=file+".pk.best.fas"
newName=shortAli_name+".longNames"
with open(shortAli_name, 'r') as shortAli, open(newName, 'w') as f2:
for line2 in shortAli:
if line2.startswith(">"):
oriName=longSpNames[line2.strip()]+'\n'
f2.write(oriName.replace(" ", "|"))
else:
f2.write(line2)
# Copy the original similarity_group_*.fasta files into the Prank Output folder. Then run python vespa_ChangeNamesToOriginalLongFormat.py in the folder where all of these files are, you should get all the files written with the extension "*.longNames"
# CodeML cannot take headers that are longer than 30 character. To shorten the Ensembl headers to 30 characters or less (needed by CodeML) - remove the transcript ID
sed -ic '/|ENS/s/...................$//' similarity_group_0028.fasta.mu
# Finds the pattern |ENS, and in that line, substitutes the last 19 characters with nothing. -ic means it modifies the files and makes a backup copy of the original file. I found NCBI gene ID headers to be smaller than 30 characters (once the gene description was removed) so there was no need to shorten those again.
Alignment comparison function¶
The metal_compare
function is designed to fully automate MSA comparison and scoring. The function operates using the third-party program MetAl [Blackburne and Whelan, 2012] to compare two protein MSAs. If MetAl indicates that the two MSAs are dissimilar, the function employs the third-party program NorMD [Thompson et al., 2001] to score each protein MSA using column-based similarity. The MSA with the highest NorMD (i.e. column-based similarity) score is then selected for subsequent analysis. It should be noted that the metal_compare
function requires the option -compare
to operate.
$ python vespa.py metal_compare –input=USR_INPUT -compare=USR_INPUT
Command-specific options: The metal_compare
function incorporates one additional option (-metal_cutoff
) that may be configured by the user. The -metal_cutoff
option assigns the numeric threshold determining MSA dissimilarity and by default is fixed at 5%. Alignment methods that yield MetAl scores lower than defined value are considered comparable and the function will select the MSA from the first alignment method (indicated using the -input
option).
$ python vespa.py metal_compare –input=USR_INPUT -compare=USR_INPUT - metal_cutoff=0.10
Note
Supported file format(s): -input
and -compare
: fasta formatted files (nexus to be added in a future release).
Note
Vespa metAl works if you make sure headers are identical between all the different alignments. (reintroduce long gene ID headers into the Prank alignments). But not for MAFFT – somehow it doesn’t recognize the Mafft alignment. Tried Mafft single line fasta file as well, didn’t work. Does not recognize the input format as an alignment
python vespa.py metal_compare -input=Prank_Output_Longnames/ -compare=Muscle_Output/
Empirical model selection functions¶
The prottest_setup
function: This function is designed to automate the process of identifying the best-fit model of amino acid replacement for a specified protein alignment using the third-party program ProtTest3 [Darriba et al., 2011]. The function is designed to test each amino acid substitution model in both the absence and presence of invariant sites, gamma categories, and a combination of the two.
$ python vespa.py prottest_setup –input=USR_INPUT
Note
Supported file format(s): -input
fasta formatted files (nexus to be added in a future release).
The prottest_reader
function: This function automates the process of reading the output of ProtTest3. The function creates two output files: best_models.csv and best_supported_models.csv. The best models file reports the best-fit model of amino acid replacement (± rate-heterogeneity) reported by ProtTest3 whereas the best supported file reports the best-fit model of amino acid replacement (± rate-heterogeneity) supported by the third-party phylogenetic reconstruction program MrBayes [Ronquist and Huelsenbeck, 2003]. The two output files are given to enable the user to use different phylogenetic reconstruction software if desired.
usr$ python vespa.py prottest_reader –input=USR_INPUT
Note
Supported file format(s): -input
: prottest3 standard output format.
mrbayes_setup
¶
The mrbayes_setup
function (Fig. 6) is designed to simplify the process of phylogenetic reconstruction using the third-party program MrBayes [Ronquist and Huelsenbeck, 2003]. The function begins by converting each protein MSA into the nexus format (Fig. 6a). Each nexus-formatted MSA is then appended with a standardized MrBayes command block that defines the variables required for phylogenetic reconstruction (Fig. 6b-d), they include the number of MCMC generations, the number of chains (trees) to be examined per generation, the temperature of the heated chain, the burn-in percentage, and the best-fit model of amino acid replacement (see Empirical model selection functions). Please note that the mrbayes_setup
function requires the option -model_list
to operate. The model_list
option is used to target the ‘best_supported_models.csv’ output file generated by the protest_reader
function (see Empirical model selection functions).
$ python vespa.py mrbayes_setup –input=USR_INPUT –model_list=MODEL_DATA
Note
Supported file format(s): input
: fasta formatted files (nexus and phylip formats to be added in a future release).
Command-specific options: The mrbayes_setup
function incorporates multiple options (-mcmc_gen
, -mcmc_chains
, -mcmc_temp
, -mcmc_burnin
) for permitting the user to alter variables within the MrBayes command block (Fig. 6b-d). The mcmc_gen
option sets the number of generations for the phylogenetic reconstruction and should be increased from the default value of 200,000 if previous attempts failed to converge. The remaining options have the following recommended settings by default: mcmc_chains
i.e. the number of chains (default = 4), mcmc_temp
i.e. the temperature of the heated chain (default = 0.2), and mcmc_burnin
, i.e. the burn-in percentage respectfully (default = 0.25).
$ python vespa.py mrbayes_setup –input=USR_INPUT –model_list=MODEL_DATA -mcmc_gen=100000
$ python vespa.py mrbayes_setup –input=USR_INPUT –model_list=MODEL_DATA -mcmc_chains=6
$ python vespa.py mrbayes_setup –input=USR_INPUT –model_list=MODEL_DATA -mcmc_temp=0.3
$ python vespa.py mrbayes_setup –input=USR_INPUT –model_list=MODEL_DATA -mcmc_burnin=0.3
Overview of mrbayes_setup
.

The MrBayes input file is described as follows: (a) The NEXUS file is separated into two blocks, a sequence alignment block and a MrBayes command block. (b) The specific commands within the MrBayes command block are each assigned default values (in bold) based on recommend values and previous commands. (c) The commands lset and prset by default are automatically assigned by VESPA from the best_supported_models.csv
file (see Empirical model selection functions) specified by the model_list
option. (d) The remaining commands are assigned based on recommended values, but may configured by the user is desired.